PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc02752.1.g00170.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family MYB
Protein Properties Length: 452aa    MW: 48589.2 Da    PI: 10.2755
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc02752.1.g00170.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding30.96.3e-1077112137
                                   TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-H CS
               Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtl 37 
                                   rg W + Ed +l ++v+++G+ +W++Ia+++  gR++
  Zmw_sc02752.1.g00170.1.am.mk  77 RGHWRPAEDAKLRELVALYGPQNWNLIAEKLD-GRSG 112
                                   899*****************************.**98 PP

2Myb_DNA-binding51.81.9e-16162204246
                                   SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
               Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                                    +++ eE+e+l  a++ +G++ W+ Iar ++ gRt++ +k++w+ 
  Zmw_sc02752.1.g00170.1.am.mk 162 RPFSDEEEERLMAAHRFYGNK-WAMIARLFP-GRTDNAVKNHWHV 204
                                   689******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129410.45572127IPR017930Myb domain
SuperFamilySSF466895.67E-875115IPR009057Homeodomain-like
SMARTSM007170.003476157IPR001005SANT/Myb domain
PfamPF002495.2E-977113IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.6E-2278111IPR009057Homeodomain-like
CDDcd001671.49E-780112No hitNo description
SuperFamilySSF466893.51E-21144214IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.6E-22144162IPR009057Homeodomain-like
PROSITE profilePS5129424.91156210IPR017930Myb domain
SMARTSM007174.9E-13160208IPR001005SANT/Myb domain
PfamPF002491.1E-12161203IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.1E-20163209IPR009057Homeodomain-like
CDDcd001671.34E-10163203No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010199Biological Processorgan boundary specification between lateral organs and the meristem
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 452 aa     Download sequence    Send to blast
MPCSSPPPPW LLQLGSAAAD QASSSTSSRG GGRVLTGGTT TMDTGATAGG GAGGGGGGNA  60
ADHQESSSSG QSRLAARGHW RPAEDAKLRE LVALYGPQNW NLIAEKLDGR SGACVRVPSL  120
AFRVRFRSTI PSAFCFASTD WIIGKSCRLR WFNQLDPRIS KRPFSDEEEE RLMAAHRFYG  180
NKWAMIARLF PGRTDNAVKN HWHVIMARKY REQSTAYRRR KLNQAVQRKL EAAATATASA  240
LPPSAAGDVV VGHHHHLLAA HDAAACFGDP YGAFALRHYC SFPFPGAAEE PPPPFYLFPG  300
TLIIPLLHAM PDISPVAAPA DRQTRLENHC SHAQKHGCAQ QYIHRIVVVV RDMPTHKWIA  360
PLGGARRSGP VRPLLLAAMY PGVNALLEIG SDGRLETMVL AALEDLDFQR PTVPRTACAT  420
GPARRPPTPA SSPGSISTSS RHRRAPPGAP SS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-27772097107B-MYB
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015695613.11e-103PREDICTED: transcription factor MYB23-like
TrEMBLA0A0E0LV691e-110A0A0E0LV69_ORYPU; Uncharacterized protein
STRINGGRMZM2G428555_P031e-105(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP29438260